DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and Cmtm6

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_080312.1 Gene:Cmtm6 / 67213 MGIID:2447165 Length:183 Species:Mus musculus


Alignment Length:157 Identity:37/157 - (23%)
Similarity:67/157 - (42%) Gaps:21/157 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TTNGPPGGANPTVGSGGGFWSAIRL-NIDYFRTIPGIIKIVEFVLGIICMALAAP-PLASATSFF 77
            ||...||...   |:..|..:...| .:.:.|.|...::::..:|..||..:.:. .|.....||
Mouse    10 TTEAAPGTGR---GARSGLAAYFVLGRLPWHRRILKGLQLLLSLLAFICEEVVSECGLCGGLYFF 71

  Fly    78 MFVIVISFIINILLIAAYFLGIREALNV--AVNWIFSELITTAVLTLLYFIGFIVQLARWSDATG 140
            .||...:|::::||:..|...:.:.::.  ..:..|...:.|..:.||..|.|:        :|.
Mouse    72 EFVSCSAFLLSLLLLIVYCTPVHDRVDTGKVKSSDFYITLGTGCVFLLASIIFV--------STH 128

  Fly   141 KGSGSNTAAGVFGLFNFLAYAAGTYFL 167
            .|:.:..||.|||      :.|.:.||
Mouse   129 SGTSAEIAAIVFG------FLASSMFL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 28/125 (22%)
Cmtm6NP_080312.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5452
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004831
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.