DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and CMTM6

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_060271.1 Gene:CMTM6 / 54918 HGNCID:19177 Length:183 Species:Homo sapiens


Alignment Length:159 Identity:38/159 - (23%)
Similarity:66/159 - (41%) Gaps:23/159 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TTNGPPGGA-NPTVGSGGGFWSAIRLNIDYFRTIPGIIKIVEFVLGIICMALAAP-PLASATSFF 77
            ||...||.| .|..|....|:..   .:...|.:...::::..:|..||..:.:. .|.....||
Human    10 TTEEDPGPARGPRSGLAAYFFMG---RLPLLRRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYFF 71

  Fly    78 MFVIVISFIINILLIAAYFLGIREALNV--AVNWIFSELITTAVLTLLYFIGFIVQLARWSDATG 140
            .||...:|::::|::..|.....|.::.  ..:..|...:.|..:.||..|.|:        :|.
Human    72 EFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFV--------STH 128

  Fly   141 KGSGSNTAAGVFGLFNFLAYAAGTYFLFL 169
            ..:.:..||.|||   |:|     .|:||
Human   129 DRTSAEIAAIVFG---FIA-----SFMFL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 27/125 (22%)
CMTM6NP_060271.1 MARVEL 58..153 CDD:307448 26/108 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5443
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004831
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.