DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and PLLP

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_057077.1 Gene:PLLP / 51090 HGNCID:18553 Length:182 Species:Homo sapiens


Alignment Length:166 Identity:45/166 - (27%)
Similarity:74/166 - (44%) Gaps:14/166 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TTTTNGPPGGANPTVGSGGGFWSAIRLNIDYFRTIPGIIKIVEFVLGIICMALAAPP---LASAT 74
            :|.|:.|..||..:|       ||:|.::.:.|:..|.:.:::.|||::..||.|..   |..|.
Human     9 STRTSSPAQGAEASV-------SALRPDLGFVRSRLGALMLLQLVLGLLVWALIADTPYHLYPAY 66

  Fly    75 SFFMFVIVISFIINILLIAAYFLGIREALNVAVNWIFSELITTAVLTLLYFIGFIVQLARWSDAT 139
            .:.|||.|..:::.|:|...|...:...|.: |.|....:|.....|:||...||...|.....:
Human    67 GWVMFVAVFLWLVTIVLFNLYLFQLHMKLYM-VPWPLVLMIFNISATVLYITAFIACSAAVDLTS 130

  Fly   140 GKGS---GSNTAAGVFGLFNFLAYAAGTYFLFLAHR 172
            .:|:   ....||..|.....:||....:|.:.|.|
Human   131 LRGTRPYNQRAAASFFACLVMIAYGVSAFFSYQAWR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 33/128 (26%)
PLLPNP_057077.1 MARVEL 32..160 CDD:307448 33/128 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1455336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6640
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.