DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and Myadm

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001087233.1 Gene:Myadm / 50918 MGIID:1355332 Length:320 Species:Mus musculus


Alignment Length:92 Identity:25/92 - (27%)
Similarity:43/92 - (46%) Gaps:7/92 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YFRTIPGIIKIVEFVLGIICMALAAPPL----ASATSFFMFVIVISFIINILLIAAYFLGIREAL 103
            |..|:||::|:.|..:..|..|..:.||    ..|..:.:.|..|.||:..:.|   .|.:.:..
Mouse   162 YMATVPGLLKVFETFVACIIFAFISEPLLYNQKPALEWCVAVYAICFILAGVTI---LLNLGDCT 223

  Fly   104 NVAVNWIFSELITTAVLTLLYFIGFIV 130
            ||......:.|...|:|::|::...||
Mouse   224 NVLPIPFPTFLSGLALLSVLFYATAIV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 25/92 (27%)
MyadmNP_001087233.1 MARVEL 39..146 CDD:366555
MARVEL 162..311 CDD:366555 25/92 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.