DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and Cmtm4

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001165622.1 Gene:Cmtm4 / 498902 RGDID:1565098 Length:208 Species:Rattus norvegicus


Alignment Length:165 Identity:45/165 - (27%)
Similarity:77/165 - (46%) Gaps:16/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ERTTTTTTNGPPGGANPT---VGSGGGFWSAIRLNIDYFRTIPGIIKIVEFVLGI---ICM--AL 65
            |.::|:..:|......||   |....|. :.:|.:.||.|...|.:|:.:.:|.:   ||:  .:
  Rat    13 EASSTSMISGASSPYQPTTEPVSQRRGL-AGLRCDPDYLRGALGRLKVAQVILALIAFICIETIM 76

  Fly    66 AAPPLASATSFFMFVIVISFIINILLIAAYFLGIREALNVAVNWIFSELITTAVLTLLYFIGFIV 130
            ...| .....||.||...:|::..:|:..:.|.:...: ..:||..::|:.|.:.|..:||..||
  Rat    77 ECSP-CEGLYFFEFVSCSAFVVTGVLLILFSLNLHMRI-PQINWSLTDLVNTGLSTFFFFIASIV 139

  Fly   131 QLARWSDATGKGSGSNTAAGVFGLFNFLAYAAGTY 165
             ||    |....:|:..||.:||.....|||..|:
  Rat   140 -LA----ALNHKTGAEIAAVIFGFLATAAYAVSTF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 36/128 (28%)
Cmtm4NP_001165622.1 MARVEL 49..170 CDD:279608 36/128 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5352
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004831
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107749
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.720

Return to query results.
Submit another query.