DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and cmtm4

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001002492.1 Gene:cmtm4 / 436765 ZFINID:ZDB-GENE-040718-195 Length:208 Species:Danio rerio


Alignment Length:172 Identity:48/172 - (27%)
Similarity:80/172 - (46%) Gaps:19/172 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ERTTTTTTNGPPGGANPTVGS--GGGFWSAIRLNIDYFRTIPGIIKIVEFVLGII------CMAL 65
            |.:.|:..:|......||...  ....:.|||.:.:|.::..||:|::|.||.:|      .:.:
Zfish    13 EASNTSMISGVNSPYQPTTEPVLSRNVFRAIRCDREYLKSHFGILKVIEVVLALISFIFIETIMM 77

  Fly    66 AAPPLASATSFFMFVIVISFIINILLIAAYFLGIREALNVAVNWIFSELITTAVLTLLYFIGFIV 130
            .:|  .:....|.||...:|::..:|:..:.|.:...: ..:||..::||.||..|..:|:..:|
Zfish    78 CSP--CAGVYLFEFVSCSAFVVTGVLLLIFSLNLHTKV-PHINWSLTDLINTATSTFFFFLASVV 139

  Fly   131 QLARWSDATGKGSGSNTAAGVFGLFNFLAYAAGTYFLFLAHR 172
             ||    |....||:..||.:||......||..|   |||.|
Zfish   140 -LA----ALNHQSGAEIAAVIFGFLVMAVYALNT---FLASR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 36/128 (28%)
cmtm4NP_001002492.1 MARVEL 49..170 CDD:279608 36/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5428
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004831
OrthoInspector 1 1.000 - - oto41070
orthoMCL 1 0.900 - - OOG6_107749
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6640
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.