DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and cmtm6

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001038221.1 Gene:cmtm6 / 368348 ZFINID:ZDB-GENE-030729-15 Length:189 Species:Danio rerio


Alignment Length:174 Identity:43/174 - (24%)
Similarity:72/174 - (41%) Gaps:36/174 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IERTTTTTTNGPPGGANPTVGSGGGFWSAIRLNI--DYFRTIPGIIKIVEFVLGIICMAL----- 65
            :..||||.    |..||.:.|     |    .|:  :...||..:||:||.:|..:...:     
Zfish     7 VYNTTTTA----PAQANKSKG-----W----FNVPSENLETIRFVIKVVEMLLSFVAFVMEEVVS 58

  Fly    66 ---AAPPLASATSFFMFVIVISFIINILLIAAYFLGIREALNVAVNWIFSELITTAVLTLLYFIG 127
               :..||    .||.||...:|:..:||:......:.:.:.:.. |...:...|:.:.:::.|.
Zfish    59 HCASCGPL----YFFEFVSCTAFLFTLLLLILLATSLHQRVGIKC-WPTLDFTYTSGMAVMFLIA 118

  Fly   128 FIVQLARWSDATGKG-SGSNTAAGVFGLFNFLA-YAAGTYFLFL 169
            .||      .|.|.| :|....|..||..:.:| :|...||:.|
Zfish   119 SIV------FAAGNGRTGLEQGAVAFGFMSTIAFFAEAAYFVKL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 30/132 (23%)
cmtm6NP_001038221.1 MARVEL 32..152 CDD:279608 30/130 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5428
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004831
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.