DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and CG1572

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001285126.1 Gene:CG1572 / 32098 FlyBaseID:FBgn0030309 Length:160 Species:Drosophila melanogaster


Alignment Length:177 Identity:50/177 - (28%)
Similarity:74/177 - (41%) Gaps:34/177 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VNIERTTTTTTNGPPGGANPTVGSGGGFWSAIRLNIDYFRTIPGIIKIVEFVLGIICMALAA--- 67
            |.|.||||:|||                .|.|.||..|.:|.|||:|:.|.::|...:.:.|   
  Fly     5 VTITRTTTSTTN----------------TSYIVLNTGYLKTFPGILKLFELIIGASIVGILAFNY 53

  Fly    68 ----PPLASATSFFMFVIVISFIINILLIAAYFLGIREALNVAVNWIFSELITTAVLTLLYFIGF 128
                .........|.:::.::|:|....:....|.......:....|: |||..:|..:|..:..
  Fly    54 QDYHRYFYGQQDLFHYLMAVTFMIGTFCLLLACLTSLSTGGIIAKTIY-ELIYHSVAAILILVSS 117

  Fly   129 IVQLARWSDATGKGSGSNTAAGVFGLFNFLAYAAGTYFL--FLAHRS 173
            .:.|.:..|..   ..:..||||.||.|     |..||:  ||||||
  Fly   118 TILLLKLRDVK---HDAYMAAGVLGLVN-----AVLYFISAFLAHRS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 29/129 (22%)
CG1572NP_001285126.1 MARVEL 26..152 CDD:279608 31/134 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22776
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.