DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and CG12730

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster


Alignment Length:136 Identity:38/136 - (27%)
Similarity:58/136 - (42%) Gaps:26/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YFRTIPGIIKIV----EFVLGIICMALAAPPLAS--ATSFFMFVIVISFIINILLIAAYFLGIRE 101
            |..::||:.|:.    .|| ||:|: :..|...|  ..||::.|:.|.|:....|:.|.:|.:.:
  Fly    13 YLLSMPGLCKLACLLCSFV-GILCI-ICGPVRVSNFRGSFYLAVVTIGFVATGCLLLARYLRLWQ 75

  Fly   102 ALNVAVNWIFSELITTAVLTLLYFI--GFIVQLARWSDATGKGSGSNTAAGVFGLFNFL-----A 159
            ......:.....|...:.|.|.||.  |.::.|         ..|:.|||..|||..|.     |
  Fly    76 RQFCRCDPTLWSLAVHSSLALAYFTASGLVLSL---------DIGAYTAAAFFGLTAFCINGLEA 131

  Fly   160 YAAGTY 165
            |  |.|
  Fly   132 Y--GNY 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 38/136 (28%)
CG12730NP_001284896.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22776
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.