DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and Plp2

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_997484.1 Gene:Plp2 / 302562 RGDID:1587363 Length:151 Species:Rattus norvegicus


Alignment Length:140 Identity:37/140 - (26%)
Similarity:61/140 - (43%) Gaps:14/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SGGGFWSAIRLNIDYFRTIPGIIKIVEFVLGIICMALAAPPLASATSFFMFVIVISFIINILLIA 93
            |..|.|.|.   ..:.||..||:...|.:|.::.:..    .:::||.:..:.||..|...:|..
  Rat     8 SAPGCWLAC---TSFSRTKKGILLFAEIILCLVILIC----FSASTSAYSSLSVIEMIFAAVLFV 65

  Fly    94 AYFLGIREALNVAVNWIFSELITTAVLTLLYFIGFIVQLARWSDATGKGSGSNTAAGVFGLFNFL 158
            .|...:...::. :||.:::...:.:..:||.|..||.|..     |:|| |...|||.||...|
  Rat    66 FYMCDLHSKISF-INWPWTDFFRSLIAAILYLITSIVVLVE-----GRGS-SKIVAGVLGLLATL 123

  Fly   159 AYAAGTYFLF 168
            .:....|..|
  Rat   124 LFGYDAYITF 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 31/122 (25%)
Plp2NP_997484.1 MARVEL 19..131 CDD:366555 31/122 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.