DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and Cmtm3

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001099634.1 Gene:Cmtm3 / 291813 RGDID:1308763 Length:184 Species:Rattus norvegicus


Alignment Length:173 Identity:41/173 - (23%)
Similarity:71/173 - (41%) Gaps:54/173 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TTNGPPGGANPTVGSGGGFWSAIRLNIDYFRTIPGIIKIVEFVLGIIC-----MALAAPPLA--- 71
            :|:||..|                      ||:||:..::. ....:|     :.||...|:   
  Rat    14 STHGPRSG----------------------RTVPGLRALLP-ARAFLCSLKGRLLLAESGLSFIT 55

  Fly    72 ------SATSFFMFVIVISFIINILLIAAYFLGIREALNV-----AVNWIFSELITTAVLTLLYF 125
                  |:.|.|:.|.::.|     |:|.||| ..:|:.:     .:.|...:.:......|:||
  Rat    56 FVCYVVSSASAFLTVPLLEF-----LLAIYFL-FADAMQLNDKWQGLCWPMMDFLRCVTAALIYF 114

  Fly   126 IGFIVQLARWSDATGKGSGSNTAAGVFGLFNFLAYAAGTYFLF 168
            :..|..:|::|:      |:..||||||.|..:.:|...|.:|
  Rat   115 VISITAVAKYSE------GAYKAAGVFGFFATIVFAIDFYLIF 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 35/141 (25%)
Cmtm3NP_001099634.1 MARVEL 36..149 CDD:366555 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.