DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and Cmtm5

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001099504.2 Gene:Cmtm5 / 290214 RGDID:1307045 Length:156 Species:Rattus norvegicus


Alignment Length:151 Identity:30/151 - (19%)
Similarity:58/151 - (38%) Gaps:20/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTVGSGGGFWSAIRLNIDYFRTIPGIIKIVEFVLGIICMALAAPPLASATSFFMFVIVISFIINI 89
            |..|:..|. ....::..:..::.||:...|..|..|....    ..::.|.:|...::.|.|.:
  Rat    12 PEEGTAAGL-QGFGVDKTFLSSLKGILLETELALTFIIFIC----FTASISAYMAAALLEFFITL 71

  Fly    90 LLIAAYFLGIREALNVAVNWIFSELI--TTAVLTLLYFIGFIVQLARWSDATGKGSGSNTAAGVF 152
            ..:..|.....:..: .:||...:.:  .:|::..|     :|..|    |.....|:..||.||
  Rat    72 AFLFLYATQCYQRFD-RLNWPCLDFLRCLSAIIIFL-----VVSFA----AVTSREGAAIAAFVF 126

  Fly   153 GLFNFLAYAAGTYFLFLAHRS 173
            |:.....:|   |..|..:|:
  Rat   127 GIILVSVFA---YDAFKIYRT 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 24/124 (19%)
Cmtm5NP_001099504.2 MARVEL 29..139 CDD:279608 25/126 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.