DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and Mal

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_036930.1 Gene:Mal / 25263 RGDID:3037 Length:153 Species:Rattus norvegicus


Alignment Length:158 Identity:39/158 - (24%)
Similarity:59/158 - (37%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTVGSGGGFWSAIRLNIDYFRTIPGIIKIVEFVLG-----IICMALAAPPLASATSFFMFVIVIS 84
            |...|||   |.:......|.|.|.::.|.||:.|     :|..:|...||..  .:.|||.|..
  Rat     3 PAAASGG---STLPSGFSVFVTFPDLLFIFEFIFGGLVWILIASSLVPMPLVQ--GWVMFVSVFC 62

  Fly    85 FIINILLIAAYFLGIREALNVAVNWIFSELITTAVLTLLYFIGFIVQ----LARWSDATGKGSGS 145
            |:....|:..|.:|....   ..:||..:.....|..|.|....:::    :..:...|.:....
  Rat    63 FLATTSLMVMYIIGTHGG---ETSWITLDAAYHCVAALFYLSASVLEALATITMFDGFTYRHYHE 124

  Fly   146 NTAAGVFGLFNFLAYAAGTYFLFLAHRS 173
            |.||.||.....|.|.....|..:..:|
  Rat   125 NIAAVVFAYVATLLYVIHAVFSLIRWKS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 32/131 (24%)
MalNP_036930.1 MARVEL 19..145 CDD:366555 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.