DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and F28H1.4

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001021426.1 Gene:F28H1.4 / 185084 WormBaseID:WBGene00017909 Length:270 Species:Caenorhabditis elegans


Alignment Length:171 Identity:43/171 - (25%)
Similarity:72/171 - (42%) Gaps:18/171 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTTTTTTNGPPGGANPTVGSGGGFWSAI-----RLNIDYFRTIPGIIKIVEFVLGII--CMALAA 67
            :||||...     ....:|:.|   .|:     ||:.:|.||:.||:|||..||.::  ...:..
 Worm    88 QTTTTVVE-----TTEYIGNDG---PAVRIEFPRLDCEYIRTLGGIMKIVCIVLCLLTFIFVMMG 144

  Fly    68 PPLASATSFFMFVIVISFIINILLIAAYFLGIREALNVAVNWIFSELITTAVLTLLYFIGFIVQL 132
            |...:...:..||..:...:...|:..|...:.:.| .::|||..|::.....|:.:||...|..
 Worm   145 PAYYTGVGWATFVSSVGIFVTTSLLTLYLFRVVDTL-PSINWIVCEMVYCFAWTVFFFIAACVLA 208

  Fly   133 ARWSDATGKGSGSNTAAGVFGLFNFLAYAAGTYFLFLAHRS 173
            ...|...|..:.:..|...||.  ..||....|..||:.::
 Worm   209 VASSQFRGTFAWAIAAFFAFGA--MCAYGFDCYLKFLSWKN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 31/124 (25%)
F28H1.4NP_001021426.1 MARVEL 118..>217 CDD:366555 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6640
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.