DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and CMTM8

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_011531718.1 Gene:CMTM8 / 152189 HGNCID:19179 Length:196 Species:Homo sapiens


Alignment Length:197 Identity:45/197 - (22%)
Similarity:74/197 - (37%) Gaps:45/197 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTTTTTTNGPPGGANPTVGSGGGFWSAIRLNIDYFRTIPGIIKIVEFVLG--------------- 59
            |:.|.||.......|.:..|     |:...:.::.||:||.:.:.|.::.               
Human     8 RSHTVTTTASSFAENFSTSS-----SSFAYDREFLRTLPGFLIVAEILISLPITDPLHRSALSTT 67

  Fly    60 ---IICMALAAPPLASATSFF--------MFVIVISFIINILLIAAY----FLGIREALNVAVNW 109
               |:.:.|....|.:.|.:|        |||.|..:::.:..:..|    :..|.:     |.|
Human    68 ARDILVLGLLVWTLIAGTEYFRVPAFGWVMFVAVFYWVLTVFFLIIYITMTYTRIPQ-----VPW 127

  Fly   110 IFSELITTAVLTLLYFIGFIVQLARWSDATGKGSGSNTAAGVFGLFNFL---AYAAGTYFLFLAH 171
            ....|.......:||....:|..:..|......:.::.||..|  |.||   .||..|||.|:|.
Human   128 TTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSF--FAFLVTICYAGNTYFSFIAW 190

  Fly   172 RS 173
            ||
Human   191 RS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 32/155 (21%)
CMTM8XP_011531718.1 MARVEL 72..185 CDD:279608 26/119 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1455336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.