Sequence 1: | NP_001096945.1 | Gene: | CG15211 / 32006 | FlyBaseID: | FBgn0030234 | Length: | 177 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011531718.1 | Gene: | CMTM8 / 152189 | HGNCID: | 19179 | Length: | 196 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 45/197 - (22%) |
---|---|---|---|
Similarity: | 74/197 - (37%) | Gaps: | 45/197 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 RTTTTTTNGPPGGANPTVGSGGGFWSAIRLNIDYFRTIPGIIKIVEFVLG--------------- 59
Fly 60 ---IICMALAAPPLASATSFF--------MFVIVISFIINILLIAAY----FLGIREALNVAVNW 109
Fly 110 IFSELITTAVLTLLYFIGFIVQLARWSDATGKGSGSNTAAGVFGLFNFL---AYAAGTYFLFLAH 171
Fly 172 RS 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15211 | NP_001096945.1 | MARVEL | 43..166 | CDD:279608 | 32/155 (21%) |
CMTM8 | XP_011531718.1 | MARVEL | 72..185 | CDD:279608 | 26/119 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4788 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1455336at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |