DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and CMTM1

DIOPT Version :10

Sequence 1:NP_572653.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_443725.3 Gene:CMTM1 / 113540 HGNCID:19172 Length:286 Species:Homo sapiens


Alignment Length:85 Identity:22/85 - (25%)
Similarity:41/85 - (48%) Gaps:5/85 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GIIKIVEFVLGIICMALAAPPLASATSFFMFVIVISFIINILLIAAYFLGIREALNVAVNWIFSE 113
            |::||:.  |.:|..|||...:..|...|:.:..:...|.:..|..|.|.:...|.. ::|...:
Human   137 GMLKILR--LSLILGALACFIITQANESFITITSLEICIVVFFILIYVLTLHHLLTY-LHWPLLD 198

  Fly   114 LITTAVLTLLYFIGFIVQLA 133
            | |.:::|.: |:..:..||
Human   199 L-TNSIITAV-FLSVVAILA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_572653.1 MARVEL 43..166 CDD:366555 22/85 (26%)
CMTM1NP_443725.3 MARVEL 131..237 CDD:366555 22/85 (26%)

Return to query results.
Submit another query.