DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and CMTM1

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_443725.3 Gene:CMTM1 / 113540 HGNCID:19172 Length:286 Species:Homo sapiens


Alignment Length:85 Identity:22/85 - (25%)
Similarity:41/85 - (48%) Gaps:5/85 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GIIKIVEFVLGIICMALAAPPLASATSFFMFVIVISFIINILLIAAYFLGIREALNVAVNWIFSE 113
            |::||:.  |.:|..|||...:..|...|:.:..:...|.:..|..|.|.:...|.. ::|...:
Human   137 GMLKILR--LSLILGALACFIITQANESFITITSLEICIVVFFILIYVLTLHHLLTY-LHWPLLD 198

  Fly   114 LITTAVLTLLYFIGFIVQLA 133
            | |.:::|.: |:..:..||
Human   199 L-TNSIITAV-FLSVVAILA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 22/85 (26%)
CMTM1NP_443725.3 MARVEL 131..>216 CDD:296526 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.