DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and cmtm8a

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_005159589.3 Gene:cmtm8a / 101886542 ZFINID:ZDB-GENE-060503-738 Length:210 Species:Danio rerio


Alignment Length:183 Identity:42/183 - (22%)
Similarity:65/183 - (35%) Gaps:56/183 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTTTTTTNGPP---GGANPTVGSGGGFWSAIRLNIDYFRTIPGIIKIVEFVLGIICMALAAPPLA 71
            |...||.:.|.   |.:     |.|..||.:        ::...:...|.:||::..     ||.
Zfish    53 RPVITTASSPYLEFGNS-----STGTLWSIL--------SVANCLVCAEIILGLLVW-----PLI 99

  Fly    72 SATSFF--------MFVIVISFIINILLIAAYFLGIREALNVA------VNWIFSELITTAVLTL 122
            ::|.:|        |||.|..:::.:.|:         .:|||      :.|....||......|
Zfish   100 ASTEYFRFSPFGWVMFVTVFYWLLTLFLL---------IINVANRHRKHMQWTTVVLIFNCTAAL 155

  Fly   123 LYFIGFIVQLARWSDATGKGSGSNTAAGVFGLFNFLAYAAGTYFLFLAHRSGA 175
            .|....||:....:..            |.|...|..:||.|:|.||...|.|
Zfish   156 FYTSAAIVEATLLNQV------------VKGHHTFNCWAASTFFAFLVSLSYA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 28/136 (21%)
cmtm8aXP_005159589.3 MARVEL 77..201 CDD:307448 33/154 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1455336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.