DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and cmtm4

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_002933695.1 Gene:cmtm4 / 100498042 XenbaseID:XB-GENE-983615 Length:207 Species:Xenopus tropicalis


Alignment Length:161 Identity:43/161 - (26%)
Similarity:75/161 - (46%) Gaps:16/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ERTTTTTTNGPPGGANPT---VGSGGGFWSAIRLNIDYFRTIPGIIKIVEFVLGIICM-----AL 65
            |.::|:..:|......||   |..|.|..| ||.::.|.|::.||:|.::.||.:...     .:
 Frog    14 EASSTSMVSGASSPYQPTTEPVMQGRGLRS-IRCDLAYIRSLFGILKCIQVVLSLFAFISIETIM 77

  Fly    66 AAPPLASATSFFMFVIVISFIINILLIAAYFLGIREALNVAVNWIFSELITTAVLTLLYFIGFIV 130
            ...| .....||.||...:|::..:|:..:...:...: ..:||..::|..|.:..|.:||..::
 Frog    78 ECSP-CEGLYFFEFVSCSAFVVTGVLLFLFSFSLHTRI-PHINWSMTDLGNTIISALFFFIASVI 140

  Fly   131 QLARWSDATGKGSGSNTAAGVFGLFNFLAYA 161
             ||    :....||:..:|.|||....|:||
 Frog   141 -LA----SLNHKSGAEISAAVFGFLATLSYA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 32/124 (26%)
cmtm4XP_002933695.1 MARVEL 50..171 CDD:366555 32/124 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004831
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6640
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.