DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and cmtm8

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_002941860.1 Gene:cmtm8 / 100380017 XenbaseID:XB-GENE-959266 Length:170 Species:Xenopus tropicalis


Alignment Length:170 Identity:39/170 - (22%)
Similarity:68/170 - (40%) Gaps:10/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ERTTTTTTNGPPGGANPTVGSGGGFWSAIRLNIDYFRTIPGIIKIVEFVLGIICMALAAPP---L 70
            ||..:.|.:........|:..||    ::..:..:.|:..|::.::|.:.|::..||.|..   |
 Frog     4 ERPRSDTVSTTVSSHIETISMGG----SVAYDRSFLRSPTGVLLLMEIIFGLLVWALIAGSEYFL 64

  Fly    71 ASATSFFMFVIVISFIINILLIAAYFLGIREALNVAVNWIFSELITTAVLTLLYFIGFIVQLARW 135
            ..|..:.|||.|..:::::.....|.......: ..|.|....|........||.|..||:.:..
 Frog    65 VPAFGWVMFVAVFYWVLSVFFYILYLTRANTRI-TKVPWTLVGLCFNGSAFALYLIAAIVEASSV 128

  Fly   136 SDATGKGSGSN--TAAGVFGLFNFLAYAAGTYFLFLAHRS 173
            .....:....|  ||:..|.....:.||..|||.|.:.|:
 Frog   129 DKDVHQHHNYNSWTASSFFAFVVTVCYALSTYFSFQSWRT 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 29/127 (23%)
cmtm8XP_002941860.1 MARVEL 34..161 CDD:366555 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10416
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5121
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1455336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.