DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and cmtm3

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001106448.1 Gene:cmtm3 / 100127625 XenbaseID:XB-GENE-1011270 Length:172 Species:Xenopus tropicalis


Alignment Length:137 Identity:33/137 - (24%)
Similarity:60/137 - (43%) Gaps:16/137 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SAIRLNIDYFRTIPGIIKIVEFV---LGIICMALAAPPLASATSFFMFVIVISFIINILLIAAYF 96
            ||:....::..:..|.:.:.|:|   |..||.      :||.....|.|.:|.|:..:....||.
 Frog    18 SALIPGREFLSSRKGQLLLAEWVVSFLTFICY------VASTAVGLMIVPLIEFLWALFTFYAYS 76

  Fly    97 LGIREALNVAVNWIFSELITTAVLTLLYFIGFIVQLARWSDATGKGSGSNTAAGVFGLFNFLAYA 161
            |...|.|. .:.|...:.|......::||:..:|.:::::      .|::.||.|||....:.:|
 Frog    77 LKYNEQLK-GILWPLLDFIRCVSAAIIYFVVSLVAVSKYT------CGASKAAAVFGFIATIIFA 134

  Fly   162 AGTYFLF 168
            ...|.:|
 Frog   135 IDFYMIF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 29/125 (23%)
cmtm3NP_001106448.1 MARVEL 26..139 CDD:366555 29/125 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.