DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and TCB3

DIOPT Version :10

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_013639.1 Gene:TCB3 / 854903 SGDID:S000004537 Length:1545 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:38/147 - (25%)
Similarity:64/147 - (43%) Gaps:29/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 EDQYSNAAEMAQ--------NWPNGKMLLSLCYNTKRRAL----------VVNVKQCI--NLMAM 526
            |..||....:.|        |:...||.:...|......|          .:|:|...  .|.:.
Yeast  1085 ETSYSTLKLLKQAYEEPMWLNFNGSKMKVRFLYTPTSVKLPSSESVEDTGYLNIKLISGHGLKSA 1149

  Fly   527 DNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLILTVWDK--- 588
            |.||.|||||.|.:    :..|..|:::|.:||:|::||:..........|:.:..:..||:   
Yeast  1150 DRNGYSDPFVHIFV----NDKKVFKSNIKKKTLDPVWNEDAKIPILSRSKNQVIFNVLDWDRAGD 1210

  Fly   589 --DLGKSNDFLGSLQLG 603
              |||:::..:.||::|
Yeast  1211 NDDLGQASLDVSSLEVG 1227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 FYVE_like_SF 84..172 CDD:333710
C2A_Rabphilin_Doc2 354..477 CDD:176000
C2B_Rabphilin_Doc2 499..631 CDD:176030 33/122 (27%)
TCB3NP_013639.1 COG5038 44..1335 CDD:227371 38/147 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.