DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and TCB1

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_014729.1 Gene:TCB1 / 854253 SGDID:S000005612 Length:1186 Species:Saccharomyces cerevisiae


Alignment Length:263 Identity:61/263 - (23%)
Similarity:108/263 - (41%) Gaps:64/263 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 ITPEAHTKYTR-WQRTKTV-------HKTRNPE---FNETLQFVGVEPEELGNSLIYVALFDDDK 451
            |:.|...|:.: |...|.:       .|...||   :|:.:..|.|...||.:|.:||..|.||.
Yeast   823 ISKEDKAKFDQEWNEVKELEDMYSNRQKLDLPELLQYNQGVLAVTVLNGELPDSGLYVQAFFDDN 887

  Fly   452 YGHDFLGAAKV--------------------------------------CLSTVHSTSQ------ 472
             ||....:.::                                      |:..|...:|      
Yeast   888 -GHPRFVSPRIPSRIVKNGWSGDVIIKELDKSITTFRVAKNKNYNRVEKCVCEVELPTQELVKNC 951

  Fly   473 -YRISVPLGVEDQYSNAAEMAQNW-P-NGKMLLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDP 534
             |:.|: |.:..:.|....:..:| | :.|.|.:....|....|.:..:...||:|.|.||.|||
Yeast   952 YYKPSI-LHLSGEGSAKLMLQISWFPIDTKQLPANDLITNSGDLTIMSRSAENLIASDLNGYSDP 1015

  Fly   535 FVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLILTVWDKDLGKSNDFLGS 599
            ::|..:..:  ::..:||.|..:||||.:|:|...:.: :.|| ::|.:.|.|.|...::|.:|:
Yeast  1016 YLKYYINNE--EDCAYKTKVVKKTLNPKWNDEGTIQIN-NRLN-DVLRIKVMDWDSTSADDTIGT 1076

  Fly   600 LQL 602
            .::
Yeast  1077 AEI 1079

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 25/134 (19%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 31/104 (30%)
TCB1NP_014729.1 COG5038 1..1182 CDD:227371 61/263 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I2514
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.