Sequence 1: | NP_572651.1 | Gene: | Rph / 32002 | FlyBaseID: | FBgn0030230 | Length: | 638 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_014729.1 | Gene: | TCB1 / 854253 | SGDID: | S000005612 | Length: | 1186 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 263 | Identity: | 61/263 - (23%) |
---|---|---|---|
Similarity: | 108/263 - (41%) | Gaps: | 64/263 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 398 ITPEAHTKYTR-WQRTKTV-------HKTRNPE---FNETLQFVGVEPEELGNSLIYVALFDDDK 451
Fly 452 YGHDFLGAAKV--------------------------------------CLSTVHSTSQ------ 472
Fly 473 -YRISVPLGVEDQYSNAAEMAQNW-P-NGKMLLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDP 534
Fly 535 FVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLILTVWDKDLGKSNDFLGS 599
Fly 600 LQL 602 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rph | NP_572651.1 | PHD_SF | 84..172 | CDD:304600 | |
C2A_Rabphilin_Doc2 | 354..477 | CDD:176000 | 25/134 (19%) | ||
C2B_Rabphilin_Doc2 | 499..631 | CDD:176030 | 31/104 (30%) | ||
TCB1 | NP_014729.1 | COG5038 | 1..1182 | CDD:227371 | 61/263 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 61 | 1.000 | Domainoid score | I2514 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000025 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |