DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and AT1G66360

DIOPT Version :10

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_564873.1 Gene:AT1G66360 / 842954 AraportID:AT1G66360 Length:174 Species:Arabidopsis thaliana


Alignment Length:108 Identity:26/108 - (24%)
Similarity:52/108 - (48%) Gaps:16/108 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 LVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLN 577
            |.::|.:.:||...|:. ||||:|.:::     ..:|.:|.|..:.||..:||:.....:...|.
plant     8 LRLHVIRGVNLAIRDSQ-SSDPYVIVRM-----GKQKLRTRVMKKNLNTEWNEDLTLSVTDPTLP 66

  Fly   578 KEMLILTVWDKDLGKSNDFLGSLQLGAQSKGERLQQWLDCIRL 620
            .:::   |:|:|....:|.:|....       .:..:|:.||:
plant    67 VKIM---VYDRDRFSRDDKMGDAIF-------HIDPFLEAIRI 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 FYVE_like_SF 84..172 CDD:333710
C2A_Rabphilin_Doc2 354..477 CDD:176000
C2B_Rabphilin_Doc2 499..631 CDD:176030 26/108 (24%)
AT1G66360NP_564873.1 C2_ArfGAP 5..150 CDD:176003 26/108 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.