DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and AT1G48590

DIOPT Version :10

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_001185174.1 Gene:AT1G48590 / 841280 AraportID:AT1G48590 Length:200 Species:Arabidopsis thaliana


Alignment Length:136 Identity:34/136 - (25%)
Similarity:68/136 - (50%) Gaps:31/136 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 LVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLN 577
            |.:.:|:.:||...|.| ||||:|.:::     ..:|.||.|.::.:||.:||:.....|..:|.
plant    44 LRIRIKRGVNLAVRDLN-SSDPYVVVKM-----AKQKLKTRVIYKNVNPEWNEDLTLSVSDPNLT 102

  Fly   578 KEMLILTVWDKDLGKSNDFLGSLQLGAQSKGERLQQWLDCIRLPDHFHE-------------KWH 629
               ::|||:|.|....:|.:|..:.|       ::.:::.:::  |.|:             :.:
plant   103 ---VLLTVYDYDTFTKDDKMGDAEFG-------IKPFVNALKM--HLHDLPSGTIVTTVQPSRDN 155

  Fly   630 CLAPDN 635
            |||.::
plant   156 CLAEES 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 FYVE_like_SF 84..172 CDD:333710
C2A_Rabphilin_Doc2 354..477 CDD:176000
C2B_Rabphilin_Doc2 499..631 CDD:176030 31/130 (24%)
AT1G48590NP_001185174.1 C2_ArfGAP 41..184 CDD:176003 34/136 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.