DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and AT1G23140

DIOPT Version :10

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_173727.1 Gene:AT1G23140 / 838922 AraportID:AT1G23140 Length:165 Species:Arabidopsis thaliana


Alignment Length:90 Identity:29/90 - (32%)
Similarity:51/90 - (56%) Gaps:9/90 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 LVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLN 577
            |.:.||:.|||::.|:| :|||||.:.:     .::|.||.....:.||.:::|  .....:|.|
plant     8 LRIRVKRGINLVSRDSN-TSDPFVVVTM-----GSQKLKTRGVENSCNPEWDDE--LTLGINDPN 64

  Fly   578 KEMLILTVWDKDLGKSNDFLGSLQL 602
            :. :.|.|:|||...|:|.:|..::
plant    65 QH-VTLEVYDKDTFTSHDPMGDAEI 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 FYVE_like_SF 84..172 CDD:333710
C2A_Rabphilin_Doc2 354..477 CDD:176000
C2B_Rabphilin_Doc2 499..631 CDD:176030 29/90 (32%)
AT1G23140NP_173727.1 C2_ArfGAP 5..148 CDD:176003 29/90 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.