DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and AT5G37740

DIOPT Version :10

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_001190431.1 Gene:AT5G37740 / 833752 AraportID:AT5G37740 Length:178 Species:Arabidopsis thaliana


Alignment Length:135 Identity:33/135 - (24%)
Similarity:60/135 - (44%) Gaps:35/135 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 LVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNK-----------KHKTSVKWRTLNPIYNEE 566
            |.::||:.:|| |:.:..||||::.:      |..|           |.||.|...::||.:|::
plant     8 LRIHVKRGVNL-AIRDISSSDPYIVV------HCGKQNLMRLLNCWSKLKTRVVKHSVNPEWNDD 65

  Fly   567 FYFEASPHDLNKEMLILTVWDKDLGKSNDFLGSLQLGAQSKGERLQQWLDCIRLPDHFHEKWHCL 631
            .....:..:|   .:.|||:|.||..::|.:|..:.       .:..:::.|:..       |.|
plant    66 LTLSVTDPNL---PIKLTVYDYDLLSADDKMGEAEF-------HIGPFIEAIKFA-------HQL 113

  Fly   632 APDNP 636
            .|..|
plant   114 GPGLP 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 FYVE_like_SF 84..172 CDD:333710
C2A_Rabphilin_Doc2 354..477 CDD:176000
C2B_Rabphilin_Doc2 499..631 CDD:176030 30/128 (23%)
AT5G37740NP_001190431.1 C2 5..161 CDD:472691 33/135 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.