DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and SYTD

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_196671.2 Gene:SYTD / 830978 AraportID:AT5G11100 Length:569 Species:Arabidopsis thaliana


Alignment Length:327 Identity:89/327 - (27%)
Similarity:135/327 - (41%) Gaps:101/327 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 LDCTMVRARDLPAMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKTRNPEFNETLQFVGVEP 434
            ||..:|:|:||...|..|.:|||..:.|......||     :|||:..:.||.:||..:|:   .
plant   266 LDVKVVQAKDLANKDMIGKSDPYAIVFIRPLPDRTK-----KTKTISNSLNPIWNEHFEFI---V 322

  Fly   435 EELGNSLIYVALFDDDKYG-HDFLGAAKVCLSTVHSTSQYRISVPLGVEDQYSNAA---EMAQNW 495
            |::....:.|.:|||:..| ...:|||:|.|:.:         ||..|:|.:....   |:.::.
plant   323 EDVSTQHLTVRVFDDEGVGSSQLIGAAQVPLNEL---------VPGKVKDIWLKLVKDLEIQRDT 378

  Fly   496 PN-GKMLLSLCY----------------------------------NTKRRALVVNVKQCI---- 521
            .| |::.|.|.|                                  .|..:.||.:.|:.:    
plant   379 KNRGQVQLELLYCPLGKEGGLKNPFNPDYSLTILEKVLKPESEDSDATDMKKLVTSKKKDVIVRG 443

  Fly   522 ----------NLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYF--EASPH 574
                      :|.|:|..|.:|.||.|.||   ....|.||.|...:|||::|:.|.|  |.:.|
plant   444 VLSVTVVAAEDLPAVDFMGKADAFVVITLK---KSETKSKTRVVPDSLNPVWNQTFDFVVEDALH 505

  Fly   575 DLNKEMLILTVWDKD-LGKSNDFLGSLQL---GAQSKGERLQQWLD---------CIRLPDHFHE 626
            ||    |.|.|||.| .||  |.:|.:.:   ....:|| .|:|.:         |:      |.
plant   506 DL----LTLEVWDHDKFGK--DKIGRVIMTLTRVMLEGE-FQEWFELDGAKSGKLCV------HL 557

  Fly   627 KW 628
            ||
plant   558 KW 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 33/107 (31%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 49/193 (25%)
SYTDNP_196671.2 SMP_LBD 69..251 CDD:293652
C2 264..368 CDD:278593 37/118 (31%)
C2 443..545 CDD:278593 38/111 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.