DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and AT3G55470

DIOPT Version :10

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_191107.1 Gene:AT3G55470 / 824713 AraportID:AT3G55470 Length:156 Species:Arabidopsis thaliana


Alignment Length:151 Identity:36/151 - (23%)
Similarity:63/151 - (41%) Gaps:34/151 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 LDCTMVRARDLPAMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKT---RNPEFNETLQFVG 431
            |:.:::..:.|...|..|..|||.::         :|....|..:|.|.   |||.:|:.|::..
plant     6 LEVSLISGKGLKRSDFLGKIDPYVEI---------QYKGQTRKSSVAKEDGGRNPTWNDKLKWRA 61

  Fly   432 VEPEELGNSLIYVALFDDDKY-GHDFLGAAKVCLSTVHSTSQYRISVPLGVEDQYSNAAEMAQNW 495
            ..|....:..:.|.:.|.|.: ..||:|.|     |||    .:..:.:|||   ...||:....
plant    62 EFPGSGADYKLIVKVMDHDTFSSDDFIGEA-----TVH----VKELLEMGVE---KGTAELRPTK 114

  Fly   496 PN---------GKMLLSLCYN 507
            .|         |::|:.:.|:
plant   115 YNIVDSDLSFVGELLIGVSYS 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 FYVE_like_SF 84..172 CDD:333710
C2A_Rabphilin_Doc2 354..477 CDD:176000 27/110 (25%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 2/9 (22%)
AT3G55470NP_191107.1 C2_putative_Elicitor-responsive_gene 4..128 CDD:176014 34/142 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.