DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and syt3

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_001186849.1 Gene:syt3 / 779540 XenbaseID:XB-GENE-956378 Length:544 Species:Xenopus tropicalis


Alignment Length:290 Identity:89/290 - (30%)
Similarity:141/290 - (48%) Gaps:37/290 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 IAISYREAFHS--LDCTMVRARDLPAMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKTRNP 421
            |:...|.|::|  |...:::|.:|||.||.|.:|||.|:.:: |:...|:    :||...||.||
 Frog   251 ISFILRYAYNSEQLVVKILKALELPAKDANGFSDPYVKMYLL-PDRKKKF----QTKVHRKTLNP 310

  Fly   422 EFNETLQFVGVEPEELGNSLIYVALFDDDKYG-HDFLGAAKVCLSTVHSTSQYRISVPLGVEDQY 485
            .||||..| .|...||.|..::.:::|.|::. ||.:|  :|.|..:.               ::
 Frog   311 IFNETFHF-NVPFNELQNRKLHFSIYDFDRFSRHDLIG--QVVLDNLL---------------EF 357

  Fly   486 SNAAEMAQNWPN-----------GKMLLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDPFVKIQ 539
            |||.:....|.:           |::..||||......|...:.:..||.|||..|.|||:||..
 Frog   358 SNATDETPIWRDILEASSEKADLGEINFSLCYLPTAGRLTATIIKATNLKAMDLTGFSDPYVKAS 422

  Fly   540 LKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLILTVWDKDLGKSNDFLGSLQLGA 604
            |..:..:.||.|||:|..||||.|||...|:....:::...|.:.|.|.|....|:.:|..::|:
 Frog   423 LICEGRRLKKRKTSIKKNTLNPTYNEALVFDIPNENMDHVSLTIAVMDYDCIGHNEVIGMCRVGS 487

  Fly   605 QSKGERLQQWLDCIRLPDHFHEKWHCLAPD 634
            .:..:..:.|.:.:..|....|.||.|..:
 Frog   488 DADMQGREHWNEMLANPRKPIEHWHQLVEE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 40/120 (33%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 43/131 (33%)
syt3NP_001186849.1 C2A_Synaptotagmin-1-5-6-9-10 248..372 CDD:176031 44/143 (31%)
C2B_Synaptotagmin-3-5-6-9-10 381..514 CDD:176048 44/132 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.