DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and SYT5

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_003171.2 Gene:SYT5 / 6861 HGNCID:11513 Length:386 Species:Homo sapiens


Alignment Length:332 Identity:104/332 - (31%)
Similarity:153/332 - (46%) Gaps:48/332 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 QTQSQYQQHQQQL--------------------------QQHCRDPLLGWLEIAISYREAFHSLD 371
            ::|:|.|.|.|::                          ||......||.|:.::.|......|.
Human    62 KSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPSGPGQQVADKHELGRLQYSLDYDFQSGQLL 126

  Fly   372 CTMVRARDLPAMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKTRNPEFNETLQFVGVEPEE 436
            ..:::|..|.|:|..|.:|||.::.:: |:...:|    .||...:|.||.|.||..| .|...|
Human   127 VGILQAMGLAALDLGGSSDPYVRVYLL-PDKRRRY----ETKVHRQTLNPHFGETFAF-KVPYVE 185

  Fly   437 LGNSLIYVALFDDDKYG-HDFLGAAKVCLSTVHSTSQYRISVPLGVEDQ---YSNAAEMAQNWPN 497
            ||..::.:|::|.|::. :|.:|..:|.:|          ||.||...|   ...||...:....
Human   186 LGGRVLVMAVYDFDRFSRNDAIGEVRVPMS----------SVDLGRPVQAWRELQAAPREEQEKL 240

  Fly   498 GKMLLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPI 562
            |.:..||.|......|.|.|.:..||..||..|.|||:||:.|.....|.:|.||::|..||||.
Human   241 GDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPY 305

  Fly   563 YNEEFYFEASPHDLNKEMLILTVWDKD-LGKSNDFLGSLQLGAQSKGERLQQWLDCIRLPDHFHE 626
            |||.|.||.....:.|..:.|||.|.| ||| |:.:|.:.:||.:.|..|:.|.|.:..|.....
Human   306 YNEAFSFEVPCDQVQKVQVELTVLDYDKLGK-NEAIGRVAVGAAAGGAGLRHWADMLANPRRPIA 369

  Fly   627 KWHCLAP 633
            :||.|.|
Human   370 QWHSLRP 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 35/123 (28%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 52/132 (39%)
SYT5NP_003171.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
C2A_Synaptotagmin-1-5-6-9-10 109..231 CDD:176031 40/137 (29%)
C2 240..374 CDD:387358 53/134 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.