DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and Syt11

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:XP_006232810.1 Gene:Syt11 / 60568 RGDID:62042 Length:430 Species:Rattus norvegicus


Alignment Length:411 Identity:100/411 - (24%)
Similarity:168/411 - (40%) Gaps:83/411 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 QQSQRPSECPEYDSVSM-----------------SKLRRESSFLRRGSVSSSWSISDSSGSGSNN 328
            ||:::..:.|.|..:.|                 .|:||:.....|.|...:..::..||..|::
  Rat    42 QQAEKKHKTPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGSHRESGRGNLLVNAESGLLSHD 106

  Fly   329 ---------------------------------SGNSQTQSQYQQHQQQLQQHCRDPLLGWLEIA 360
                                             .|.|:..|.....:        |.:||.|..:
  Rat   107 RDPRGPSPASCIDQLPIKRDYGEELRSPMTSLTPGESKPTSPSSPEE--------DVMLGSLTFS 163

  Fly   361 ISYREAFHSLDCTMVRARDLPAMDAAGL-ADPYCKLNIITPEAHTKYTRWQRTKTVHKTRNPEFN 424
            :.|.....:|..|:..|..||.||.... :|||.|:.|:..:.|.     .:|:.:.||.:|.|:
  Rat   164 VDYNFPKKALVVTIQEAHGLPVMDGQTQGSDPYIKMTILPDKRHR-----VKTRVLRKTLDPVFD 223

  Fly   425 ETLQFVGVEPEELGNSLIYVALFDDDKYGH-DFLGAAKVCLSTVH-STSQYRIS---VPLGVEDQ 484
            ||..|.|:...:|.:.:::..:...|::.. |.:|...|.|:.|. ||.:.:::   :...::..
  Rat   224 ETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKC 288

  Fly   485 YSNAAEMAQNWPNGKMLLSLCYNTKRRALVVNVKQCINLMAMDNNG-SSDPFVKIQLKPDAHKNK 548
            .|          .|::.:||.|....:.:.|.|.:..:|..||..| |.:|:||:.:.....:..
  Rat   289 IS----------RGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIA 343

  Fly   549 KHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLI-LTVWDKDLGKSNDFLGSLQLGAQS-KGERL 611
            |.||.||..|||||:||.|.::. |.||..::.| ..|.|.|....|:.:|.|.|||.| .....
  Rat   344 KKKTHVKKCTLNPIFNESFIYDI-PTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGA 407

  Fly   612 QQWLDCIRLPDHFHEKWHCLA 632
            :.|.:....|.....|||.|:
  Rat   408 EHWREVCESPRKPVAKWHSLS 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 35/128 (27%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 45/134 (34%)
Syt11XP_006232810.1 C2A_Synaptotagmin-4-11 157..282 CDD:176034 35/129 (27%)
C2B_Synaptotagmin-4 291..428 CDD:176049 46/137 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.