DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and syt2a

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:XP_021325566.1 Gene:syt2a / 567877 ZFINID:ZDB-GENE-060503-315 Length:430 Species:Danio rerio


Alignment Length:285 Identity:96/285 - (33%)
Similarity:154/285 - (54%) Gaps:20/285 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 LGWLEIAISYREAFHSLDCTMVRARDLPAMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKT 418
            ||.|:.::.|..:...|...:::|.||.:||:.|.:|||.|: .|.|:...||.    ||...||
Zfish   148 LGKLQFSLDYDFSASQLTVGILQAADLLSMDSGGTSDPYVKV-FILPDKKKKYD----TKVHKKT 207

  Fly   419 RNPEFNETLQFVGVEPEELGNSLIYVALFDDDKYG-HDFLGAAKVCLSTVHSTSQYRISVPLGVE 482
            .||.||||..| .:...|:|...:.::::|.|::. ||.:|..|:.::|:.      ::.|:   
Zfish   208 LNPVFNETFHF-KIPFTEMGGKTLVMSVYDFDRFSKHDVIGEVKIPMNTLD------LAQPI--- 262

  Fly   483 DQYS--NAAEMAQNWPNGKMLLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAH 545
            :|:.  ::||..:....|.:.:||.|......|.:.:.:..||..||..|.|||:|||.|..:..
Zfish   263 EQWRDLDSAEKEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGK 327

  Fly   546 KNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLILTVWDKD-LGKSNDFLGSLQLGAQSKGE 609
            :.||.||:||..||||.|||.|.||.....:.|...::||.|.| :|| ||.:|.:.:|::::|.
Zfish   328 RLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGK-NDAIGKIWVGSKAQGT 391

  Fly   610 RLQQWLDCIRLPDHFHEKWHCLAPD 634
            .|:.|.|.:..|.....:||.|.|:
Zfish   392 ELRHWSDMLANPRRPIAQWHPLKPE 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 39/123 (32%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 50/132 (38%)
syt2aXP_021325566.1 C2A_Synaptotagmin-1-5-6-9-10 148..270 CDD:176031 41/136 (30%)
C2B_Synaptotagmin-1 279..414 CDD:176047 51/135 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X85
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.