DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and Syt10

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_061273.1 Gene:Syt10 / 54526 MGIID:1859546 Length:523 Species:Mus musculus


Alignment Length:377 Identity:103/377 - (27%)
Similarity:177/377 - (46%) Gaps:62/377 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 RQQSQRPSECPEYDSVSMSKLRRESSFLRRGSVSSSWSISDSSGS------GSNNSGNSQTQSQ- 337
            ::|:..|:....::|     .||.  ..|:.:||   |:..|.|:      |...:...:.:.: 
Mouse   159 QRQTTEPTSSSRHNS-----FRRH--LPRQMNVS---SVDFSVGTEPILQRGETRTSIGRIKPEL 213

  Fly   338 YQQHQQQLQQHCRDPL--LGWLEIAISYREAFHSLDCTMVRARDLPAMDAAGLADPYCKLNIITP 400
            |:|.....:.:.:|.:  .|.|..|:.|......|...:::|.||||.|..|.:|||.|:.:: |
Mouse   214 YKQKSVDSEGNRKDDVKTCGKLNFALQYDYENELLVVKIIKALDLPAKDFTGTSDPYVKIYLL-P 277

  Fly   401 EAHTKYTRWQRTKTVHKTRNPEFNETLQFVGVEPEELGNSLIYVALFDDDKYG-HDFLGAAKVCL 464
            :...|:    :|:...||.||.|:|..|| .|..::|.|..::.:::|.|::. ||.:|  :|.|
Mouse   278 DRKKKF----QTRVHRKTLNPLFDELFQF-PVVYDQLSNRKLHFSIYDFDRFSRHDMIG--EVIL 335

  Fly   465 STVHSTSQYRISVPLGVEDQYSNAAEMAQNWPN-----------GKMLLSLCYNTKRRALVVNVK 518
            ..:.               :.|:.:..|..|.:           |:::.||||......:.:.|.
Mouse   336 DNLF---------------EVSDLSREATVWKDIHCATTESIDLGEIMFSLCYLPTAGRMTLTVI 385

  Fly   519 QCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLIL 583
            :|.||.|||..|||||:||:.|..:..:.||.||:.|..||||:|||...|:..|.::::..|.:
Mouse   386 KCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTTTKKNTLNPVYNEAIIFDIPPENVDQVSLCI 450

  Fly   584 TVWDKDLGKSNDFLGSLQLGAQSKGERLQQWLDCIRLPDHFHEK----WHCL 631
            .|.|.|....|:.:|..:.|..::|.....|.:.:.    :|.|    ||.|
Mouse   451 AVMDYDRVGHNEVIGVCRTGLDAEGLGRDHWNEMLA----YHRKPITHWHPL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 37/123 (30%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 46/135 (34%)
Syt10NP_061273.1 Cysteine motif. /evidence=ECO:0000250|UniProtKB:O35681 13..35
C2A_Synaptotagmin-1-5-6-9-10 231..356 CDD:176031 40/147 (27%)
C2B_Synaptotagmin-3-5-6-9-10 365..498 CDD:176048 47/136 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.