DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and Rph3al

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_083824.1 Gene:Rph3al / 380714 MGIID:1923492 Length:302 Species:Mus musculus


Alignment Length:289 Identity:102/289 - (35%)
Similarity:147/289 - (50%) Gaps:55/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NKFVCPSDRQLALRAKLKAGWS-------SSKTSEPLRPEEQEAIISVIRRNEEIEVAERQRVGR 68
            :::|||:||||||||||:.|||       ..:.|:.|.|.|.|.|:.||:|.|.:::.|:||:||
Mouse    11 DQWVCPNDRQLALRAKLQTGWSVHTYQTEKQRRSQCLSPGELEIILQVIQRAERLDILEQQRIGR 75

  Fly    69 LVERVEKIKQHAVERGPNCCRLCGDTFGILRPQRILCEDCRQSVCTKCSVDINIRYHTSERSREI 133
            ||||:|.::::.:..|.:.|.|||:..|.|....:.|:|||:.|||||.::.     :..:.|.:
Mouse    76 LVERLETMQRNVMGNGLSQCLLCGEVLGFLGSSSVFCKDCRKKVCTKCGIEA-----SPGQKRPL 135

  Fly   134 WLCRICSETREMWKKSGAWFFKGLPKYDMPRSASATPIPNPGPGSMAGDTRAVQSCHATPTRPAR 198
            |||:||||.||:||:|||||:||||||.:       |:..||    ..|....:.....||....
Mouse   136 WLCKICSEQREVWKRSGAWFYKGLPKYIL-------PLKTPG----RADDPHFRPLPVEPTETQP 189

  Fly   199 VKKLTIRV------------NDSSSSSSGHSEPEDEVDTGVGIGVGVVG----GGMAKGIASTRL 247
            ....|.||            :||.|..|..|..:..:.:||   .|..|    |.....:.|.||
Mouse   190 PSAETSRVYTWARGRVVSSDSDSDSDLSSSSLEDRPLPSGV---KGTKGDKPRGDSGASMESPRL 251

  Fly   248 QREDSFRLRAYGSIR--SFIDGGERKLSN 274
                       |..|  |.:.|.:..|.:
Mouse   252 -----------GPARPPSHLSGSQSSLGS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600 40/87 (46%)
C2A_Rabphilin_Doc2 354..477 CDD:176000
C2B_Rabphilin_Doc2 499..631 CDD:176030
Rph3alNP_083824.1 FYVE_2 45..159 CDD:308117 53/118 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..302 23/110 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849700
Domainoid 1 1.000 126 1.000 Domainoid score I5386
eggNOG 1 0.900 - - E1_KOG1013
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185575at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.