DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and Doc2g

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:XP_006230797.1 Gene:Doc2g / 293654 RGDID:1307473 Length:389 Species:Rattus norvegicus


Alignment Length:300 Identity:102/300 - (34%)
Similarity:159/300 - (53%) Gaps:25/300 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 LGWLEIAISYREAFHSLDCTMVRARDLPAMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKT 418
            ||.||..:.:.....:|.||..||:.|.. .|.|..|.|.|.|:: |.|........||:||..|
  Rat    84 LGTLEFTLLFDVDNSTLHCTAHRAKGLKP-PATGSVDTYVKANLL-PGASKVRASQLRTRTVRGT 146

  Fly   419 RNPEFNETLQFVGVEPEELGNSLIYVALFDDDKYGH----DFLGAAKV---------------CL 464
            |.|.:.|||.:.|...::.|...:.:.:.:|.:...    ..||..:|               ||
  Rat   147 REPVWEETLTYHGFTCQDAGRKTLRLCVCEDSRLRRRRRAPPLGELRVPLRKLVPNRARSFDICL 211

  Fly   465 STVHSTSQYR-ISVPLGVE--DQYSNAAEMAQNWPNGKMLLSLCYNTKRRALVVNVKQCINLMAM 526
            .....|.:.: :....|:.  ::....||:.:. ..|::||||||:::|..|:|.|.:|.:|..|
  Rat   212 EKRRLTKRPKSLDTARGMSLYEEEEVEAEVFRE-ERGRILLSLCYSSERGGLLVGVLRCAHLAPM 275

  Fly   527 DNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLILTVWDKDLG 591
            |.||.|||||::.|.|.:.|..|:||||:.:||||.:||||::.....:|.::.|:::|||.|||
  Rat   276 DANGYSDPFVRLFLHPSSGKKSKYKTSVRRKTLNPEFNEEFFYAGLREELAQKALLVSVWDYDLG 340

  Fly   592 KSNDFLGSLQLGAQSKGERLQQWLDCIRLPDHFHEKWHCL 631
            .::||:|.:||..:|.|:||:.|.:|:...|...|.||.|
  Rat   341 TADDFIGGVQLSGRSSGDRLRHWCECLSHCDRRLELWHLL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 37/142 (26%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 60/131 (46%)
Doc2gXP_006230797.1 C2A_Rabphilin_Doc2 84..211 CDD:176000 34/128 (27%)
C2 248..380 CDD:301316 60/131 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5232
eggNOG 1 0.900 - - E1_KOG1013
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185575at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 1 1.000 - - otm44766
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45729
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.