DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and SYT11

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:XP_016856248.1 Gene:SYT11 / 23208 HGNCID:19239 Length:434 Species:Homo sapiens


Alignment Length:416 Identity:106/416 - (25%)
Similarity:168/416 - (40%) Gaps:89/416 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 QQSQRPSECPEYDSVSM-----------------SKLRR-------------------ESSFLRR 309
            ||:::..:.|.|..:.|                 .|:||                   |:..|.|
Human    42 QQAEKKQKNPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSR 106

  Fly   310 ---------GSVSSSWSISDSSGS------GSNNSGNSQTQSQYQQHQQQLQQHCRDPLLGWLEI 359
                     ||......|....|.      .|...|.|:|.|.....:        |.:||.|..
Human   107 DKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPSSPEE--------DVMLGSLTF 163

  Fly   360 AISYREAFHSLDCTMVRARDLPAMD--AAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKTRNPE 422
            ::.|.....:|..|:..|..||.||  ..| :|||.|:.|:..:.|.     .:|:.:.||.:|.
Human   164 SVDYNFPKKALVVTIQEAHGLPVMDDQTQG-SDPYIKMTILPDKRHR-----VKTRVLRKTLDPV 222

  Fly   423 FNETLQFVGVEPEELGNSLIYVALFDDDKYGH-DFLGAAKVCLSTVH-STSQYRIS---VPLGVE 482
            |:||..|.|:...:|.:.:::..:...|::.. |.:|...|.|:.|. ||.:.:::   :...::
Human   223 FDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQ 287

  Fly   483 DQYSNAAEMAQNWPNGKMLLSLCYNTKRRALVVNVKQCINLMAMDNNGSS----DPFVKIQLKPD 543
            ...|          .|::.:||.|....:.:.|.|.:..:|..||..|.|    ||:||:.:...
Human   288 KCIS----------RGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGRAPDPYVKVNVYYG 342

  Fly   544 AHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLI-LTVWDKDLGKSNDFLGSLQLGAQS- 606
            ..:..|.||.||..|||||:||.|.::. |.||..::.| ..|.|.|....|:.:|.|.|||.| 
Human   343 RKRIAKKKTHVKKCTLNPIFNESFIYDI-PTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSV 406

  Fly   607 KGERLQQWLDCIRLPDHFHEKWHCLA 632
            .....:.|.:....|.....|||.|:
Human   407 TASGAEHWREVCESPRKPVAKWHSLS 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 36/129 (28%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 46/137 (34%)
SYT11XP_016856248.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.