DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and Syt4

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_033334.2 Gene:Syt4 / 20983 MGIID:101759 Length:425 Species:Mus musculus


Alignment Length:313 Identity:86/313 - (27%)
Similarity:145/313 - (46%) Gaps:28/313 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 SGSNNSGNSQTQSQYQQHQQQLQQHCRDPLLGWLEIAISYREAFHSLDCTMVRARDLPAMDAAGL 388
            :.|..|..|.|....::.|::         ||.|.:::.|.....:....:..|:.|||||...:
Mouse   133 ANSPESLKSSTSLTSEEKQEK---------LGTLFLSLEYNFEKKAFVVNIKEAQGLPAMDEQSM 188

  Fly   389 -ADPYCKLNIITPEAHTKYTRWQRTKTVHKTRNPEFNETLQFVGVEPEELGNSLIYVALFDDDKY 452
             :|||.|:.|:..:.|.     .:|:.:.||.:|.|:||..|.|:....:....::..:...|::
Mouse   189 TSDPYIKMTILPEKKHR-----VKTRVLRKTLDPVFDETFTFYGIPYPHIQELSLHFTVLSFDRF 248

  Fly   453 GH-DFLGAAKVCLSTVHSTSQYRISVPLGVEDQYSNAAEMAQNWPNGKMLLSLCYNTKRRALVVN 516
            .. |.:|...:.||.:..:....:   :..|....||.:.:   ..|::|:||||.:....|.|.
Mouse   249 SRDDVIGEVLIPLSGIELSDGKML---MTREIIKRNAKKSS---GRGELLVSLCYQSTTNTLTVV 307

  Fly   517 VKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFE---ASPHDLNK 578
            |.:..:|...|.:|.|||:||:.|.....:..|.||.||..|.|.::||.|.|:   .|..:::.
Mouse   308 VLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESLEEISV 372

  Fly   579 EMLILTVWDKDLGKSNDFLGSLQLGAQSKGERLQQWLDCIRLPDHFHEKWHCL 631
            |.|:|   |.:.|..|:.:|.|.|||.::|.....|.:....|.....|||.|
Mouse   373 EFLVL---DSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHML 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 30/124 (24%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 46/134 (34%)
Syt4NP_033334.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..147 4/13 (31%)
C2A_Synaptotagmin-4-11 153..279 CDD:176034 31/142 (22%)
C2B_Synaptotagmin-4 288..423 CDD:176049 48/138 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.