DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and snt-3

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_001379881.1 Gene:snt-3 / 190698 WormBaseID:WBGene00004923 Length:284 Species:Caenorhabditis elegans


Alignment Length:288 Identity:98/288 - (34%)
Similarity:150/288 - (52%) Gaps:27/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 LGWLEIAISYREAFHSLDCTMVRARDLPAMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKT 418
            ||.|:..:.|....:||...:::|.:|||||..|.:|||.|| .:.|:...|.    :||...|:
 Worm    16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKL-FLLPDKKKKL----QTKVQRKS 75

  Fly   419 RNPEFNETLQFVGVEPEELGNSLIYVALFDDDKYG-HDFLGAAKVCLSTVHSTSQYRISVPLGVE 482
            .||.|||:..| .:...|:|...:.:.:||.|::| ||.:|               :||:|||..
 Worm    76 LNPVFNESFTF-KIPFNEIGGQTLVLNVFDFDRFGKHDQIG---------------QISIPLGKV 124

  Fly   483 DQYS--NAAEMAQNWPN---GKMLLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDPFVKIQLKP 542
            |..:  ...::.::.|.   |::.|:|.|...:..|.|.|.:|.||..||..|.|||:|||.|..
 Worm   125 DLAATLERTDLIESPPENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMM 189

  Fly   543 DAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLILTVWDKDLGKSNDFLGSLQLGAQSK 607
            ...:.:|.||::|.:||||.|||.|.|:.:...:.:..|.:||.|.|...||:.:|.:.:|..:.
 Worm   190 GTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGTCAT 254

  Fly   608 GERLQQWLDCIRLPDHFHEKWHCLAPDN 635
            |..|:||.|.:..|.....:||.|.|.|
 Worm   255 GVALKQWNDMLATPRRSVAQWHTLVPFN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 39/123 (32%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 49/131 (37%)
snt-3NP_001379881.1 C2 16..131 CDD:417471 44/135 (33%)
C2B_Synaptotagmin-1 144..278 CDD:176047 50/133 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.