DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and esyt-2

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_001366808.1 Gene:esyt-2 / 175882 WormBaseID:WBGene00020443 Length:808 Species:Caenorhabditis elegans


Alignment Length:170 Identity:42/170 - (24%)
Similarity:84/170 - (49%) Gaps:8/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 SDSSGS-GSNNSGNSQTQSQYQ-QHQQQLQQHCRDPLLGWLEIAISYREAFHSLDCTMVRARDLP 381
            |||.|| .|:...||:....:: :|:.:.::...|...|.:||.|.:.:..:.|...::|.|||.
 Worm   639 SDSQGSLNSHGRSNSRLGRLFRSKHEMKKRETRADENRGEIEIQIDFDDLVNQLKIALIRCRDLM 703

  Fly   382 AMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKTRNPEFNETLQFVGVEPEELGNSLIYVAL 446
            ..|.....:||..:.::..:.:.:..: ::|.|...||:|.|:..:: :.:.|.:|.|..:.:.:
 Worm   704 TFDKKDQCNPYVSVKLVALDGNKEVFK-KKTPTAKNTRHPHFDNHVE-IDINPSDLLNHKVVINV 766

  Fly   447 FDDDKYG----HDFLGAAKVCLSTVHSTSQYRISVPLGVE 482
            .||..||    ...||..::.|.::.:....:..:||.||
 Worm   767 KDDTNYGTFVAKPVLGCLEIRLDSLMNRQLSQRWIPLSVE 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 28/126 (22%)
C2B_Rabphilin_Doc2 499..631 CDD:176030
esyt-2NP_001366808.1 SMP_LBD 83..260 CDD:293652
C2A_C2C_Synaptotagmin_like 276..394 CDD:176037
C2B_Synaptotagmin-like 424..528 CDD:176015
C2 691..800 CDD:214577 24/110 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.