DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and SYT6

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_001353153.1 Gene:SYT6 / 148281 HGNCID:18638 Length:528 Species:Homo sapiens


Alignment Length:278 Identity:87/278 - (31%)
Similarity:146/278 - (52%) Gaps:13/278 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 GWLEIAISYREAFHSLDCTMVRARDLPAMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKTR 419
            |.:..::.|.....:|...:::|.||||.|..|.:|||.|:.:: |:...|.    :|:...||.
Human   231 GKINFSLRYDYETETLIVRILKAFDLPAKDFCGSSDPYVKIYLL-PDRKCKL----QTRVHRKTL 290

  Fly   420 NPEFNETLQFVGVEPEELGNSLIYVALFDDDKYG-HDFLGAAKVCLSTVHSTSQYRISVPLGVED 483
            ||.|:|...| .|..|||.:..:::::||.|::. ||.:|  :|.|..:...|.......:..:.
Human   291 NPTFDENFHF-PVPYEELADRKLHLSVFDFDRFSRHDMIG--EVILDNLFEASDLSRETSIWKDI 352

  Fly   484 QYSNAAEMAQNWPNGKMLLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNK 548
            ||:.    :::...|:::.||||......|.:.|.:|.||.|||..|.|||:||:.|..|..:.|
Human   353 QYAT----SESVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLK 413

  Fly   549 KHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLILTVWDKDLGKSNDFLGSLQLGAQSKGERLQQ 613
            |.||::|..||||:|||...|:..|.::::..|:::|.|.|....|:.:|..::|..::|.....
Human   414 KKKTTIKKNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGITAEGLGRDH 478

  Fly   614 WLDCIRLPDHFHEKWHCL 631
            |.:.:..|......||.|
Human   479 WNEMLAYPRKPIAHWHSL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 37/122 (30%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 46/131 (35%)
SYT6NP_001353153.1 Cysteine motif. /evidence=ECO:0000250|UniProtKB:O35681 12..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..178
C2A_Synaptotagmin-1-5-6-9-10 230..354 CDD:176031 37/130 (28%)
C2B_Synaptotagmin-3-5-6-9-10 363..496 CDD:176048 47/132 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.