DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and Doc2a

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_001355284.1 Gene:Doc2a / 13446 MGIID:109446 Length:405 Species:Mus musculus


Alignment Length:305 Identity:118/305 - (38%)
Similarity:175/305 - (57%) Gaps:25/305 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 LGWLEIAISYREAFHSLDCTMVRARDLPAMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKT 418
            ||.||..:.|.:|...|.|.::||:.|..||..||||||.||::: |.| .|..: .:|||...|
Mouse    95 LGTLEFDLLYDQASCMLHCRILRAKGLKPMDFNGLADPYVKLHLL-PGA-CKANK-LKTKTQRNT 156

  Fly   419 RNPEFNETLQFVGVEPEELGNSLIYVALFDDDKYGH-DFLGAAKVCLSTVHSTSQYRIS------ 476
            .||.:||.|.:.|:..:::.:.::.:::.|:||..| :|:|..:|.|..:..:.:...:      
Mouse   157 LNPVWNEELTYSGITDDDITHKVLRISVCDEDKLSHNEFIGEIRVPLRRLKPSQKKHFNICLERQ 221

  Fly   477 VPLGVEDQYSNA----------AEMAQNWP-----NGKMLLSLCYNTKRRALVVNVKQCINLMAM 526
            |||......|.|          .|.|:..|     .|::||||.|:::|..|:|.:.:|.:|.||
Mouse   222 VPLPSPSSMSAALRGISCYLKELEQAEQGPGLLEERGRILLSLSYSSRRHGLLVGIVRCAHLAAM 286

  Fly   527 DNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLILTVWDKDLG 591
            |.||.|||:||..|:||..|..||||.||.:||||.:||||::|.....|..:.|.:||||.|:|
Mouse   287 DVNGYSDPYVKTYLRPDVDKKSKHKTCVKKKTLNPEFNEEFFYEIELSTLATKTLEVTVWDYDIG 351

  Fly   592 KSNDFLGSLQLGAQSKGERLQQWLDCIRLPDHFHEKWHCLAPDNP 636
            |||||:|.:.||..::||..:.|.||:..||...|:||.|..:.|
Mouse   352 KSNDFIGGVSLGPGARGEAQKHWNDCLHQPDTALERWHTLTSELP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 42/129 (33%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 65/131 (50%)
Doc2aNP_001355284.1 Interaction with UNC13D and DYNLT1. /evidence=ECO:0000250 1..94
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..54
C2A_Rabphilin_Doc2 95..218 CDD:176000 42/125 (34%)
Interaction with UNC13D. /evidence=ECO:0000250 220..405 76/177 (43%)
C2B_Rabphilin_Doc2 259..391 CDD:176030 65/131 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5346
eggNOG 1 0.900 - - E1_KOG1013
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 348 1.000 Inparanoid score I2281
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185575at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 1 1.000 - - otm42701
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45729
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2745
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.960

Return to query results.
Submit another query.