DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and SYT2

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:XP_016855798.1 Gene:SYT2 / 127833 HGNCID:11510 Length:479 Species:Homo sapiens


Alignment Length:334 Identity:103/334 - (30%)
Similarity:166/334 - (49%) Gaps:43/334 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 GSGSNNSGNSQ------------------TQSQYQQHQQQLQQHCRDPLLGWLEIAISYREAFHS 369
            |.|..|:.|.:                  |:.:.:..:::..::     ||.|:.::.|....:.
Human   156 GKGMKNAMNMKDMKGGQLPQDDDDAETGLTEGEGEGEEEKEPEN-----LGKLQFSLDYDFQANQ 215

  Fly   370 LDCTMVRARDLPAMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKTRNPEFNETLQFVGVEP 434
            |...:::|.:|||:|..|.:|||.|: .:.|:...||    .||...||.||.||||..| .|..
Human   216 LTVGVLQAAELPALDMGGTSDPYVKV-FLLPDKKKKY----ETKVHRKTLNPAFNETFTF-KVPY 274

  Fly   435 EELGNSLIYVALFDDDKYG-HDFLGAAKVCLSTVHSTSQYRISVPLGVEDQYSNAAEMAQNWPN- 497
            :|||...:.:|::|.|::. ||.:|..||.::||.      :..|:   :::.:.....:..|. 
Human   275 QELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVD------LGQPI---EEWRDLQGGEKEEPEK 330

  Fly   498 -GKMLLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNP 561
             |.:..||.|......|.|.:.:..||..||..|.|||:|||.|..:..:.||.||:||.:||||
Human   331 LGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNP 395

  Fly   562 IYNEEFYFEASPHDLNKEMLILTVWDKD-LGKSNDFLGSLQLGAQSKGERLQQWLDCIRLPDHFH 625
            .:||.|.||.....:.|..:::||.|.| ||| |:.:|.:.:|:.:.|..|:.|.|.:..|....
Human   396 YFNESFSFEIPFEQIQKVQVVVTVLDYDKLGK-NEAIGKIFVGSNATGTELRHWSDMLANPRRPI 459

  Fly   626 EKWHCLAPD 634
            .:||.|.|:
Human   460 AQWHSLKPE 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 43/123 (35%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 50/132 (38%)
SYT2XP_016855798.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.