DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and doc2a

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:XP_031748920.1 Gene:doc2a / 101730387 XenbaseID:XB-GENE-922476 Length:391 Species:Xenopus tropicalis


Alignment Length:332 Identity:123/332 - (37%)
Similarity:179/332 - (53%) Gaps:31/332 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 GSNNSGNSQTQSQYQQHQQQLQQHCRDPLLGWLEIAISYREAFHSLDCTMVRARDLPAMDAAGLA 389
            |:..:.:|.....|...:        ...||.||..:.|......|.|.::||:.|..||..|||
 Frog    65 GAETADDSADVDNYDSDE--------STALGTLEFDLLYDPEQCILQCCILRAKGLKPMDFNGLA 121

  Fly   390 DPYCKLNIITPEAHTKYTRWQRTKTVHKTRNPEFNETLQFVGVEPEELGNSLIYVALFDDDKYGH 454
            |||.|:::: |.| .|..: .:|:||..:.||.:||:|.:.|:..|::|..::.:::.|:||..|
 Frog   122 DPYVKIHLL-PGA-CKANK-LKTRTVRNSLNPTWNESLTYCGITQEDMGKKILRISVCDEDKLSH 183

  Fly   455 -DFLGAAKVCLSTV------HSTSQYRISVPLGVEDQ----------YSNAAEMAQNW---PNGK 499
             :|:|..:|.|..:      |........:||.....          |....|..|.|   ..|:
 Frog   184 NEFIGETRVPLRRLKPGERKHFNLCLERQIPLASPSSMTAALRGISCYLKELERCQEWELEERGR 248

  Fly   500 MLLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYN 564
            :||||.|:::|..|||.:.:|.:|.|||.||.|||:||..||||..|..||||.||.:||||.:|
 Frog   249 ILLSLTYSSERGGLVVGIMRCAHLAAMDVNGFSDPYVKTYLKPDVEKKSKHKTVVKKKTLNPEFN 313

  Fly   565 EEFYFEASPHDLNKEMLILTVWDKDLGKSNDFLGSLQLGAQSKGERLQQWLDCIRLPDHFHEKWH 629
            |||::..|..:|.|..|.:||||.||||||||:|.:..|..||||.|:.|::|:..|:...|.||
 Frog   314 EEFFYNISQLELQKRSLEVTVWDYDLGKSNDFIGGVTFGMSSKGECLKHWMECLSTPNKRTEHWH 378

  Fly   630 CLAPDNP 636
            .|..:.|
 Frog   379 TLTNELP 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 42/129 (33%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 69/131 (53%)
doc2aXP_031748920.1 C2A_Rabphilin_Doc2 86..209 CDD:176000 42/125 (34%)
C2 248..380 CDD:417471 69/131 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5333
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185575at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 1 1.000 - - otm47802
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.