DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and syt5

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:XP_002938321.1 Gene:syt5 / 100493612 XenbaseID:XB-GENE-991349 Length:416 Species:Xenopus tropicalis


Alignment Length:286 Identity:100/286 - (34%)
Similarity:147/286 - (51%) Gaps:22/286 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 LGWLEIAISYREAFHSLDCTMVRARDLPAMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKT 418
            ||.|:.::.|......|...:::|.||||:|..|.:|||.|:.:: |:...||    .||...||
 Frog   136 LGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLL-PDKKKKY----ETKVHRKT 195

  Fly   419 RNPEFNETLQFVGVEPEELGNSLIYVALFDDDKYG-HDFLGAAKVCLSTV---HSTSQYRISVPL 479
            .||.|||:..| .|...|||...:.::::|.|::. ||.:|..:|.::||   |...::      
 Frog   196 LNPTFNESFTF-KVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEW------ 253

  Fly   480 GVEDQYSNAAEMAQNWPNGKMLLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDPFVKIQLKPDA 544
                |...:||..:....|.:..||.|......|.|.|.:..||..||..|.|||:|||.|..:.
 Frog   254 ----QDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNG 314

  Fly   545 HKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLILTVWDKD-LGKSNDFLGSLQLGAQSKG 608
            .:.||.||::|..||||.|||.|.||.....:.|..::|||.|.| ||| |:.:|.:.:|..:.|
 Frog   315 KRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVLTVLDYDKLGK-NEAIGKIFVGCNATG 378

  Fly   609 ERLQQWLDCIRLPDHFHEKWHCLAPD 634
            ..|:.|.|.:..|.....:||.|.|:
 Frog   379 TELRHWSDMLANPRRPIAQWHTLQPE 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 42/126 (33%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 52/132 (39%)
syt5XP_002938321.1 C2A_Synaptotagmin-1-5-6-9-10 135..258 CDD:176031 43/137 (31%)
C2B_Synaptotagmin-1 267..402 CDD:176047 53/135 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.