DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rph and syt19

DIOPT Version :9

Sequence 1:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster
Sequence 2:XP_001343313.4 Gene:syt19 / 100003865 ZFINID:ZDB-GENE-090602-3 Length:384 Species:Danio rerio


Alignment Length:330 Identity:71/330 - (21%)
Similarity:134/330 - (40%) Gaps:48/330 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 SSGSGSNNSGNSQTQSQYQQHQQQLQQHCRDPLLGWLEIAISYREAFHSLDCTMVRARDLPAMDA 385
            |.||...|.|::...:..:..:::..|       |.|..::.|.:....:..|::.|:||...|.
Zfish    82 SPGSSCTNLGSNLDLASLEDLEEEHIQ-------GSLRFSLFYDQLQSKMVVTVLDAQDLAVRDF 139

  Fly   386 AGLADPYCKLNIITPEAHTK--------YTRWQRTKTVHKTRNPEFNETLQFVGVEPEELGNSLI 442
            :...||:..:.::..|...|        ...|| |:.|..:..|.|.:....:..| :|:....:
Zfish   140 SHSVDPFVWVRLMWAEREDKEKNSMRCLLHEWQ-TRIVKNSCCPVFGDQFSCILAE-DEVSRVTV 202

  Fly   443 YVALFDDDKYG-HDFLGAAKVCLSTVHSTSQYRISVPLGVEDQYSNAAEMAQNW--PN----GKM 500
            ...:.|.|||. |..||..:..|:|:      :||.||          |:.|:.  |.    |:.
Zfish   203 RFEVRDFDKYSRHGVLGETRASLNTL------KISYPL----------ELRQDLQVPRKDIVGEA 251

  Fly   501 LLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNE 565
            ||||.|....:.|.|.|.: |:.:...|......:.:..:..:..:.:..:|:.|.|....::||
Zfish   252 LLSLKYMPTSQRLEVGVLK-IHTVCYHNKTERALYARTIVTCNQSRLRHQRTTQKKRREVTVFNE 315

  Fly   566 EFYFEASPHDLNKEMLILTVWDKDLGK--SNDFLGSLQLGAQSKG--ERLQQWLDCIRLPDHFHE 626
            ...|......:.:..:.::|::....|  |.:.:|.:|:.....|  |..:|.:..:|.|   ..
Zfish   316 VMTFVLPDQQIKECSIEVSVYEIQPSKKSSKNLIGHIQVKKNKTGENEHWKQMMQSLRQP---VA 377

  Fly   627 KWHCL 631
            .||.:
Zfish   378 NWHLI 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 30/131 (23%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 28/135 (21%)
syt19XP_001343313.4 C2 109..241 CDD:301316 35/149 (23%)
C2 249..382 CDD:301316 29/136 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.