DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and ATG12

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_004698.3 Gene:ATG12 / 9140 HGNCID:588 Length:140 Species:Homo sapiens


Alignment Length:80 Identity:22/80 - (27%)
Similarity:35/80 - (43%) Gaps:5/80 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IGD---LDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPT-SATMGSLYQEHHEE 101
            :||   :..||:.|....|:......|:|.:.|...:.||.:||....|: ...:|:|| |....
Human    62 VGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY-ECFGS 125

  Fly   102 DYFLYIAYSDENVYG 116
            |..|.:.|.....:|
Human   126 DGKLVLHYCKSQAWG 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 21/78 (27%)
ATG12NP_004698.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
APG12 54..140 CDD:252381 21/78 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.