DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and ATG8

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_009475.1 Gene:ATG8 / 852200 SGDID:S000000174 Length:117 Species:Saccharomyces cerevisiae


Alignment Length:116 Identity:65/116 - (56%)
Similarity:91/116 - (78%) Gaps:0/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIR 65
            ||..:|.|:.||||:||.::|..::.:|:|||.|||.|:.|.::||:|||||:|||||||.::||
Yeast     1 MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIR 65

  Fly    66 KRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 116
            |||.|.||.|:|.|||:.:|||:|.|.::||||.::|.|||:.||.||.:|
Yeast    66 KRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 62/110 (56%)
ATG8NP_009475.1 Ubl_ATG8 11..113 CDD:340545 58/101 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I1107
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134420
Inparanoid 1 1.050 145 1.000 Inparanoid score I1152
Isobase 1 0.950 - 0 Normalized mean entropy S125
OMA 1 1.010 - - QHG54038
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 1 1.000 - - otm46642
orthoMCL 1 0.900 - - OOG6_100707
Panther 1 1.100 - - O PTHR10969
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2039
SonicParanoid 1 1.000 - - X355
TreeFam 1 0.960 - -
1514.810

Return to query results.
Submit another query.