DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and MAP1LC3A

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:XP_011527385.1 Gene:MAP1LC3A / 84557 HGNCID:6838 Length:223 Species:Homo sapiens


Alignment Length:114 Identity:36/114 - (31%)
Similarity:67/114 - (58%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKEEHAFEKRRAEGDKIRRKYPDRVPVIVEK-APKARIGDLDKKKYLVPSDLTVGQFYFLIRKRI 68
            :|:..:|..|..|..:||.::|.::|||:|: ..:.::..|||.|:|||..:.:.:...:||:|:
Human   109 FKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRL 173

  Fly    69 HLRPEDALFFFVN-NVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 116
            .|.|..|.|..|| :.:...|..:..:|::..:||.|||:.|:.:..:|
Human   174 QLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 35/112 (31%)
MAP1LC3AXP_011527385.1 B_lectin 30..>71 CDD:279758
GABARAP 109..222 CDD:176355 35/112 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.