DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and ATG8C

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_176395.1 Gene:ATG8C / 842499 AraportID:AT1G62040 Length:119 Species:Arabidopsis thaliana


Alignment Length:113 Identity:62/113 - (54%)
Similarity:87/113 - (76%) Gaps:0/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIH 69
            :|.||..|:|:.|..:||.|||||:|||||:|.::.:.::||||||||:|||||||.:::||||.
plant     6 FKLEHPLERRQIESSRIREKYPDRIPVIVERAERSDVPNIDKKKYLVPADLTVGQFVYVVRKRIK 70

  Fly    70 LRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYGM 117
            |..|.|:|.||.|.:|||:|.|.::|.|:.:||.|||:.||.||.:|:
plant    71 LSAEKAIFVFVKNTLPPTAAMMSAIYDENKDEDGFLYMTYSGENTFGL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 61/110 (55%)
ATG8CNP_176395.1 Ubl_ATG8 12..114 CDD:340545 56/101 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 144 1.000 Domainoid score I1480
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I1674
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 1 1.000 - - mtm1018
orthoMCL 1 0.900 - - OOG6_100707
Panther 1 1.100 - - O PTHR10969
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X355
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.