DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and APG8A

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001078424.1 Gene:APG8A / 828287 AraportID:AT4G21980 Length:137 Species:Arabidopsis thaliana


Alignment Length:115 Identity:64/115 - (55%)
Similarity:86/115 - (74%) Gaps:0/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRK 66
            |..:|..:..|.|.:|..:||.|||||:|||||||.::.:.|:||||||||:|||||||.:::||
plant    18 KSSFKISNPLEARMSESSRIREKYPDRIPVIVEKAGQSDVPDIDKKKYLVPADLTVGQFVYVVRK 82

  Fly    67 RIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 116
            ||.|..|.|:|.||.|.:|||:|.|.::|:||.:||.|||:.||.||.:|
plant    83 RIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHKDEDGFLYMTYSGENTFG 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 62/110 (56%)
APG8ANP_001078424.1 GABARAP 21..132 CDD:176355 62/110 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 144 1.000 Domainoid score I1480
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I1674
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 1 1.000 - - mtm1018
orthoMCL 1 0.900 - - OOG6_100707
Panther 1 1.100 - - O PTHR10969
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X355
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.